PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00047g02233.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 187aa    MW: 21588.9 Da    PI: 10.6875
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00047g02233.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like93.91.3e-291972255
                   G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                              +rlrWtp+LH+ F++ v++LGG  kAtPk+i+e+m vkgL ++hvkSHLQ+YR 
  Peaxi162Scf00047g02233.1 19 TRLRWTPQLHDLFIQTVQHLGGRYKATPKRIMEMMAVKGLKISHVKSHLQMYRN 72
                              79***************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-261673IPR009057Homeodomain-like
SuperFamilySSF466894.3E-141772IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-232073IPR006447Myb domain, plants
PfamPF002497.0E-82071IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MSAHSVPEMR RQYNKSSATR LRWTPQLHDL FIQTVQHLGG RYKATPKRIM EMMAVKGLKI  60
SHVKSHLQMY RNMKGHDCSL HFVMPEFNPS TPLHVSNRLR KNAPKKESGS QFSSKESNSS  120
DKNGENIHHY DNQASLEFLG KAKLAIQALE ILEFQHRKCV RSNKTLYIVK IQSIVKRAAK  180
YPYQGLD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009601033.13e-51PREDICTED: probable transcription factor KAN4
TrEMBLM1CTB45e-46M1CTB4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000741832e-45(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA94591325
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42660.12e-22G2-like family protein